Antibody data

Product number
H00010050-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010050-M03, RRID:AB_1237865
Product name
SLC17A4 monoclonal antibody (M03), clone 3E4
Provider product page
Abnova Corporation - H00010050-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC17A4.
Antigen sequence
NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWN
ETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAP
IPSGYV
Isotype
IgG
Antibody clone number
3E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -