HPA030179

SLC17A4 antibody from MilliporeSigma / Merck KGaA
KIAA2138
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030179
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030179, RRID:AB_10610426
Product name
Anti-SLC17A4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030179
Antibody type
Polyclonal
Antigen
solute carrier family 17 (sodium phosphate), member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETL
KEFKAMAPAYDWSPE
Storage
-20C
Provider Type Product Number
- No reagents -