HPA021641

SGSM2 antibody from Atlas Antibodies
KIAA0397, RUTBC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021641
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021641, RRID:AB_2188702
Product name
Anti-SGSM2
Provider product page
Atlas Antibodies - HPA021641
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHT
LREPQDPSQEKPQAGELEAGEELAAVCAAAYTIEL
LDTVALNLHRIDKDVQRCDRNYWY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -