HPA024553

SGSM2 antibody from MilliporeSigma / Merck KGaA
KIAA0397, RUTBC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024553
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024553, RRID:AB_1856512
Product name
Anti-SGSM2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024553
Antibody type
Polyclonal
Antigen
RUN and TBC1 domain containing 1 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HRDSTISNDVFISVDDLEPPEPQDPEDSRPKPEQE
AGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVA
Storage
-20C
Provider Type Product Number
- No reagents -