HPA005695

PTPA antibody from Atlas Antibodies
PPP2R4, PR53
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005695
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005695, RRID:AB_1855658
Product name
Anti-PTPA
Provider product page
Atlas Antibodies - HPA005695
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLI
DHPYLEPRHFVDEKAVNENHKDYMFLECILFITEM
KTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAE
CLEKFPVIQHFKF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -