HPA005695

PPP2R4 antibody from Sigma-Aldrich
PR53, PTPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005695
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005695, RRID:AB_1855658
Product name
Anti-PPP2R4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005695
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase 2A regulatory subunit B' recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLI
DHPYLEPRHFVDEKAVNENHKDYMFLECILFITEM
KTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAE
CLEKFPVIQHFKF
Storage
-20C
Provider Type Product Number
- No reagents -