HPA035000

ZNF213 antibody from Atlas Antibodies
CR53, ZKSCAN21, ZSCAN53
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035000
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035000, RRID:AB_10669997
Product name
Anti-ZNF213
Provider product page
Atlas Antibodies - HPA035000
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQE
MVPVVPGQTGSDVTVSWSPEEAEAWESENRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -