Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007760-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007760-M01, RRID:AB_489772
- Product name
- ZNF213 monoclonal antibody (M01), clone 5D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF213.
- Antigen sequence
QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVP
QEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPV
ALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRN
TTLGF- Isotype
- IgG
- Antibody clone number
- 5D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZNF213 monoclonal antibody (M01), clone 5D7 Western Blot analysis of ZNF213 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZNF213 expression in transfected 293T cell line by ZNF213 monoclonal antibody (M01), clone 5D7.Lane 1: ZNF213 transfected lysate(51.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ZNF213 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol