H00007760-M02

ZNF213 antibody from Abnova Corporation
CR53, ZKSCAN21, ZSCAN53

Antibody data

Product number
H00007760-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007760-M02, RRID:AB_894337
Product name
ZNF213 monoclonal antibody (M02), clone 3D3
Provider product page
Abnova Corporation - H00007760-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF213.
Antigen sequence
QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVP
QEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPV
ALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRN
TTLGF
Isotype
IgG
Antibody clone number
3D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -