Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007760-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007760-M02, RRID:AB_894337
- Product name
- ZNF213 monoclonal antibody (M02), clone 3D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF213.
- Antigen sequence
QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVP
QEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPV
ALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRN
TTLGF- Isotype
- IgG
- Antibody clone number
- 3D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZNF213 monoclonal antibody (M02), clone 3D3 Western Blot analysis of ZNF213 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF213 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol