ABIN405159

ZNF213 antibody from antibodies-online
CR53, ZKSCAN21, ZSCAN53

Antibody data

Product number
ABIN405159
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 213 (ZNF213) antibody
Provider product page
antibodies-online - ABIN405159
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the middle region of human ZNF213
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
SFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAH
LIAHQ SLHAKMAQPV
Vial size
50 µg
Provider Type Product Number
- No reagents -