HPA023240

ZNF341 antibody from Sigma-Aldrich
dJ553F4.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023240
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023240, RRID:AB_1859207
Product name
Anti-ZNF341 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023240
Antibody type
Polyclonal
Antigen
Zinc finger protein 341 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGP
NPAAPMTSATGGTVATFDSPATLKTRRAKGARGLP
EAAGKP
Storage
-20C
Provider Type Product Number
- No reagents -