H00006283-B01P

S100A12 antibody from Abnova Corporation
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6

Antibody data

Product number
H00006283-B01P
Provider
Abnova Corporation
Product name
S100A12 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00006283-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human S100A12 protein.
Antigen sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQ
LLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD
FQEFISLVAIALKAAHYHTHKE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -