PAB28697

S100A12 antibody from Abnova Corporation
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6

Antibody data

Product number
PAB28697
Provider
Abnova Corporation
Product name
S100A12 polyclonal antibody
Provider product page
Abnova Corporation - PAB28697
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant S100A12.
Antigen sequence
KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLL
TKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQ
EFISLVAIALKAAHYHTHKE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -