H00006283-M10

S100A12 antibody from Abnova Corporation
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6

Antibody data

Product number
H00006283-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006283-M10, RRID:AB_10642482
Product name
S100A12 monoclonal antibody (M01), clone 1F10
Provider product page
Abnova Corporation - H00006283-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant S100A12.
Antigen sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQ
LLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD
FQEFISLVAIALKAAHYHTHKE
Isotype
IgG
Antibody clone number
1F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -