HPA002881

S100A12 antibody from Atlas Antibodies
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002881
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002881, RRID:AB_1234240
Product name
Anti-S100A12
Provider product page
Atlas Antibodies - HPA002881
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLL
TKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQ
EFISLVAIALKAAHYHTHKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -