HPA002881

S100A12 antibody from Sigma-Aldrich
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002881
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002881, RRID:AB_1848175
Product name
Anti-S100A12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002881
Antibody type
Polyclonal
Antigen
Protein S100-A12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLL
TKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQ
EFISLVAIALKAAHYHTHKE
Storage
-20C
Provider Type Product Number
- No reagents -