HPA016569

SLC17A3 antibody from Sigma-Aldrich
NPT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016569, RRID:AB_1856992
Product name
Anti-SLC17A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016569
Antibody type
Polyclonal
Antigen
Sodium-dependent phosphate transport protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATKTELSPTARESKNAQDMQVDETLIPRKVPSLCS
AR
Storage
-20C
Provider Type Product Number
- No reagents -