HPA016569

SLC17A3 antibody from Atlas Antibodies
NPT4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016569
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016569, RRID:AB_1235617
Product name
Anti-SLC17A3
Provider product page
Atlas Antibodies - HPA016569
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATKTELSPTARESKNAQDMQVDETLIPRKVPSLCS
AR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -