HPA018981

ZNF200 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018981
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018981, RRID:AB_1859021
Product name
Anti-ZNF200 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018981
Antibody type
Polyclonal
Antigen
Zinc finger protein 200 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHF
LTFLPKPSLVQPSQKVKETLVIMKDVSSSLQNRVH
PRPLVKLLPKGVQK
Storage
-20C
Provider Type Product Number
- No reagents -