Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005245-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005245-M01, RRID:AB_425592
- Product name
- PHB monoclonal antibody (M01), clone 3F4-2B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PHB.
- Antigen sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHR
AVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCR
SRPRNVPVITGSKDLQNVNITLRILFRPVASQLPR
IFTSIGEDYDERVLPSITTEILKSVVARFDAGELI
TQRELVSRQVSDDLTERAATFGLILDDVSLTHLTF
GKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAA
IISAEGDSKAAELIANSLATAGDGLIELRKLEAAG
DIAYQLSRSRNITYLPAGQSVLLQLPQ- Isotype
- IgG
- Antibody clone number
- 3F4-2B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gonad differential proteins revealed with proteomics in oyster (Saccostrea cucullata) using alga as food contaminated with cadmium.
Zhu B, Gao KS, Wang KJ, Ke CH, Huang HQ
Chemosphere 2012 Apr;87(4):397-403
Chemosphere 2012 Apr;87(4):397-403
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PHB monoclonal antibody (M01), clone 3F4-2B2 Western Blot analysis of PHB expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in NIH/3T3.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHB is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PHB on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol