HPA023339

RNF113B antibody from Sigma-Aldrich
RNF161, ZNF183L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023339
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023339, RRID:AB_1856322
Product name
Anti-RNF113B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023339
Antibody type
Polyclonal
Antigen
RING finger protein 113B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEHGESSSSGDEGDTVAQPPRVAPRPRGLHSWQKA
AHGDRRGEEAAPESLDVVYRSTRTAKPV
Storage
-20C
Provider Type Product Number
- No reagents -