HPA026435

STK24 antibody from Atlas Antibodies
MST-3, MST3, MST3B, STE20, STK3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026435
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026435, RRID:AB_1854151
Product name
Anti-STK24
Provider product page
Atlas Antibodies - HPA026435
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAI
YLAEEACPGISDTMVAQLVQRLQRYSLSGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -