HPA026435

STK24 antibody from Sigma-Aldrich
MST-3, MST3, MST3B, STE20, STK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026435, RRID:AB_1854151
Product name
Anti-STK24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026435
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAI
YLAEEACPGISDTMVAQLVQRLQRYSLSGG
Storage
-20C
Provider Type Product Number
- No reagents -