Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010605-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010605-M04, RRID:AB_10556020
- Product name
- PAIP1 monoclonal antibody (M04), clone 2D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PAIP1.
- Antigen sequence
YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNG
CVTTDDALQELVELIYQQATSIPNFSYMGARLCNY
LSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKG
DEVTR- Isotype
- IgG
- Antibody clone number
- 2D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PAIP1 monoclonal antibody (M04), clone 2D11. Western Blot analysis of PAIP1 expression in HeLa(Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PAIP1 expression in transfected 293T cell line by PAIP1 monoclonal antibody (M04), clone 2D11.Lane 1: PAIP1 transfected lysate(45.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PAIP1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PAIP1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol