Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184005 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Poly(A) Binding Protein Interacting Protein 1 (PAIP1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the C terminal of human PAIP1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPD
YEENG TDLSGAGDPY- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Paip1 interacts with poly(A) binding protein through two independent binding motifs.
H-Ras signaling and K-Ras signaling are differentially dependent on endocytosis.
Roy G, De Crescenzo G, Khaleghpour K, Kahvejian A, O'Connor-McCourt M, Sonenberg N
Molecular and cellular biology 2002 Jun;22(11):3769-82
Molecular and cellular biology 2002 Jun;22(11):3769-82
H-Ras signaling and K-Ras signaling are differentially dependent on endocytosis.
Roy S, Wyse B, Hancock JF
Molecular and cellular biology 2002 Jul;22(14):5128-40
Molecular and cellular biology 2002 Jul;22(14):5128-40
No comments: Submit comment
No validations: Submit validation data