HPA003881

PBX1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003881
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003881, RRID:AB_1855020
Product name
Anti-PBX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003881
Antibody type
Polyclonal
Antigen
Pre-B-cell leukemia transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNK
RIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQ
ANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDS
YQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQ
MYSP
Storage
-20C
Provider Type Product Number
- No reagents -