HPA020243

DNAAF5 antibody from Sigma-Aldrich
CILD18, FLJ20397, FLJ25564, FLJ31671, FLJ39381, HEATR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020243, RRID:AB_1848750
Product name
Anti-HEATR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020243
Antibody type
Polyclonal
Antigen
HEAT repeat-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKSAQLLPVLLLHAEDHATQHLEVVLRTLFQACTD
EEAAVVQSCTRSAELVGTFVSPEVFLKLILSTLKK
TPSASGLLVLASAMRGCPREALQPHLAAIATELAQ
AHICQASENDLYLERLLLCVQALVSVCH
Storage
-20C
Provider Type Product Number
- No reagents -