HPA026653

ERO1A antibody from Atlas Antibodies
ERO1-alpha, Ero1alpha, ERO1L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026653
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026653, RRID:AB_1848254
Product name
Anti-ERO1A
Provider product page
Atlas Antibodies - HPA026653
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRL
KNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQ
DEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEA
HKLKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -