Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030001-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030001-M01, RRID:AB_530038
- Product name
- ERO1L monoclonal antibody (M01), clone 4G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ERO1L.
- Antigen sequence
DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEA
NNLIEECEQAERLGAVDESLSEETQKAVLQWTKHD
DSSDNFCEADDIQSPEAEY- Isotype
- IgG
- Antibody clone number
- 4G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Allomyrina Dichotoma Larvae Regulate Food Intake and Body Weight in High Fat Diet-Induced Obese Mice Through mTOR and Mapk Signaling Pathways.
Ero1-α and PDIs constitute a hierarchical electron transfer network of endoplasmic reticulum oxidoreductases.
Kim J, Yun EY, Park SW, Goo TW, Seo M
Nutrients 2016 Feb 18;8(2):100
Nutrients 2016 Feb 18;8(2):100
Ero1-α and PDIs constitute a hierarchical electron transfer network of endoplasmic reticulum oxidoreductases.
Araki K, Iemura S, Kamiya Y, Ron D, Kato K, Natsume T, Nagata K
The Journal of cell biology 2013 Sep 16;202(6):861-74
The Journal of cell biology 2013 Sep 16;202(6):861-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody (M01), clone 4G3.Lane 1: ERO1L transfected lysate(54 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ERO1L monoclonal antibody (M01), clone 4G3. Western Blot analysis of ERO1L expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ERO1L is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol