HPA026653

ERO1A antibody from MilliporeSigma / Merck KGaA
ERO1-alpha, Ero1alpha, ERO1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026653
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026653, RRID:AB_1848254
Product name
Anti-ERO1L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026653
Antibody type
Polyclonal
Antigen
ERO1-like protein alpha Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRL
KNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQ
DEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEA
HKLKE
Storage
-20C
Provider Type Product Number
- No reagents -