ABIN501937

PRMT2 antibody from antibodies-online
HRMT1L1, MGC111373

Antibody data

Product number
ABIN501937
Provider
antibodies-online
Product name
anti-Protein Arginine Methyltransferase 2 (PRMT2) antibody
Provider product page
antibodies-online - ABIN501937
Antibody type
Polyclonal
Antigen
The immunogen for anti-PRMT2 antibody: synthetic peptide directed towards the N terminal of human PRMT2
Reactivity
Human, Rat
Host
Rabbit
Antigen sequence
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGS
YGTLK LHLEMLADQP
Vial size
50 µg
Provider Type Product Number
- No reagents -