HPA018976

PRMT2 antibody from Sigma-Aldrich
HRMT1L1, MGC111373
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018976
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018976, RRID:AB_1855719
Product name
Anti-PRMT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018976
Antibody type
Polyclonal
Antigen
Protein arginine N-methyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLS
TGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVL
QRNPVWRRHMSVALSW
Storage
-20C
Provider Type Product Number
- No reagents -