Antibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005645 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GNB3
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDA
SAKLWDVREGTCRQTFTGHESDINAICFFPNGEAI
CTGSDDASCRLFDLRADQELICFSHESIICGITSV
AFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGH
DNRVSC- Isotype
- IgG
- Vial size
- 110µl
- Concentration
- 0.05 mg/ml
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Deleterious Effect of NMDA Plus Kainate on the Inner Retinal Cells and Ganglion Cell Projection of the Mouse
Lack of mGluR6‐related cascade elements leads to retrograde trans‐synaptic effects on rod photoreceptor synapses via matrix‐associated proteins
Differential function of Gγ13 in rod bipolar and ON cone bipolar cells
Loss of Outer Retinal Neurons and Circuitry Alterations in the DBA/2J Mouse
Cones Respond to Light in the Absence of Transducin β Subunit
Immunocytochemical Evidence of the Localization of the Crumbs Homologue 3 Protein (CRB3) in the Developing and Mature Mouse Retina
Gβ3Is Required for Normal Light ON Responses and Synaptic Maintenance
mGluR6 deletion renders the TRPM1 channel in retina inactive
Vision-guided ocular growth in a mutant chicken model with diminished visual acuity
The pattern of expression of guanine nucleotide-binding protein β3 in the retina is conserved across vertebrate species
Calvo E, Milla-Navarro S, Ortuño-Lizarán I, Gómez-Vicente V, Cuenca N, De la Villa P, Germain F
International Journal of Molecular Sciences 2020;21(5):1570
International Journal of Molecular Sciences 2020;21(5):1570
Lack of mGluR6‐related cascade elements leads to retrograde trans‐synaptic effects on rod photoreceptor synapses via matrix‐associated proteins
Tummala S, Dhingra A, Fina M, Li J, Ramakrishnan H, Vardi N, Watanabe M
European Journal of Neuroscience 2016;43(11):1509-1522
European Journal of Neuroscience 2016;43(11):1509-1522
Differential function of Gγ13 in rod bipolar and ON cone bipolar cells
Ramakrishnan H, Dhingra A, Tummala S, Fina M, Li J, Lyubarsky A, Vardi N
The Journal of Physiology 2015;593(7):1531-1550
The Journal of Physiology 2015;593(7):1531-1550
Loss of Outer Retinal Neurons and Circuitry Alterations in the DBA/2J Mouse
Fernández-Sánchez L, de Sevilla Müller L, Brecha N, Cuenca N
Investigative Opthalmology & Visual Science 2014;55(9):6059
Investigative Opthalmology & Visual Science 2014;55(9):6059
Cones Respond to Light in the Absence of Transducin β Subunit
Nikonov S, Lyubarsky A, Fina M, Nikonova E, Sengupta A, Chinniah C, Ding X, Smith R, Pugh E, Vardi N, Dhingra A
The Journal of Neuroscience 2013;33(12):5182-5194
The Journal of Neuroscience 2013;33(12):5182-5194
Immunocytochemical Evidence of the Localization of the Crumbs Homologue 3 Protein (CRB3) in the Developing and Mature Mouse Retina
Frishman L, Herranz-Martín S, Jimeno D, Paniagua A, Velasco A, Lara J, Aijón J, Lillo C
PLoS ONE 2012;7(11):e50511
PLoS ONE 2012;7(11):e50511
Gβ3Is Required for Normal Light ON Responses and Synaptic Maintenance
Dhingra A, Ramakrishnan H, Neinstein A, Fina M, Xu Y, Li J, Chung D, Lyubarsky A, Vardi N
The Journal of Neuroscience 2012;32(33):11343-11355
The Journal of Neuroscience 2012;32(33):11343-11355
mGluR6 deletion renders the TRPM1 channel in retina inactive
Xu Y, Dhingra A, Fina M, Koike C, Furukawa T, Vardi N
Journal of Neurophysiology 2012;107(3):948-957
Journal of Neurophysiology 2012;107(3):948-957
Vision-guided ocular growth in a mutant chicken model with diminished visual acuity
Ritchey E, Zelinka C, Tang J, Liu J, Code K, Petersen-Jones S, Fischer A
Experimental Eye Research 2012;102
Experimental Eye Research 2012;102
The pattern of expression of guanine nucleotide-binding protein β3 in the retina is conserved across vertebrate species
Ritchey E, Bongini R, Code K, Zelinka C, Petersen-Jones S, Fischer A
Neuroscience 2010;169(3):1376-1391
Neuroscience 2010;169(3):1376-1391
No comments: Submit comment
No validations: Submit validation data