HPA005645

GNB3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005645
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005645, RRID:AB_1849870
Product name
Anti-GNB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005645
Antibody type
Polyclonal
Antigen
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDA
SAKLWDVREGTCRQTFTGHESDINAICFFPNGEAI
CTGSDDASCRLFDLRADQELICFSHESIICGITSV
AFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGH
DNRVSC
Storage
-20C
Provider Type Product Number
- No reagents -