Antibody data

Product number
ABIN486886
Provider
antibodies-online
Product name
anti-Homeobox D12 (HOXD12) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486886
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXD12 antibody: synthetic peptide directed towards the middle region of human HOXD12
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
AGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQ
IAELE NEFLVNEFIN
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -