Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486886 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Homeobox D12 (HOXD12) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXD12 antibody: synthetic peptide directed towards the middle region of human HOXD12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQ
IAELE NEFLVNEFIN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome.
Zhao X, Sun M, Zhao J, Leyva JA, Zhu H, Yang W, Zeng X, Ao Y, Liu Q, Liu G, Lo WH, Jabs EW, Amzel LM, Shan X, Zhang X
American journal of human genetics 2007 Feb;80(2):361-71
American journal of human genetics 2007 Feb;80(2):361-71
No comments: Submit comment
No validations: Submit validation data