Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182628 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Homeobox D12 (HOXD12) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXD12 antibody: synthetic peptide directed towards the N terminal of human HOXD12
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQ
LAALP PISYPRGALP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Spatio-temporal expression of HOX genes in human hindgut development.
Limb malformations and the human HOX genes.
Illig R, Fritsch H, Schwarzer C
Developmental dynamics : an official publication of the American Association of Anatomists 2013 Jan;242(1):53-66
Developmental dynamics : an official publication of the American Association of Anatomists 2013 Jan;242(1):53-66
Limb malformations and the human HOX genes.
Goodman FR
American journal of medical genetics 2002 Oct 15;112(3):256-65
American journal of medical genetics 2002 Oct 15;112(3):256-65
No comments: Submit comment
No validations: Submit validation data