HPA019708

SMU1 antibody from Atlas Antibodies
BWD, FLJ10805, fSAP57, SMU-1

Antibody data

Product number
HPA019708
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019708, RRID:AB_1857300
Product name
Anti-SMU1
Provider product page
Atlas Antibodies - HPA019708
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SIEIESSDVIRLIMQYLKENSLHRALATLQEETTV
SLNTVDSIESFVADINSGHWDTVLQAIQSLKLPDK
TLIDLYEQVVLELIELRELGAARSLLRQTDPMIML
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.