HPA019708

SMU1 antibody from Sigma-Aldrich
BWD, FLJ10805, fSAP57, SMU-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019708
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019708, RRID:AB_1857300
Product name
Anti-SMU1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019708
Antibody type
Polyclonal
Antigen
WD40 repeat-containing protein SMU1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIEIESSDVIRLIMQYLKENSLHRALATLQEETTV
SLNTVDSIESFVADINSGHWDTVLQAIQSLKLPDK
TLIDLYEQVVLELIELRELGAARSLLRQTDPMIML
Storage
-20C
Provider Type Product Number
- No reagents -