HPA019228

SMU1 antibody from Atlas Antibodies
BWD, FLJ10805, fSAP57, SMU-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019228
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019228, RRID:AB_1857299
Product name
Anti-SMU1
Provider product page
Atlas Antibodies - HPA019228
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL
AGEVSVVPPSRLMALLGQALKWQQHQGLLPPGMTI
DLFRGKAAVKDVEEEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -