WH0006564M1

SLC15A1 antibody from Sigma-Aldrich
HPECT1, HPEPT1, PEPT1
ELISA
Recommended by provider

Antibody data

Product number
WH0006564M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006564M1, RRID:AB_1843618
Product name
Monoclonal Anti-SLC15A1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006564M1
Antibody type
Monoclonal
Antigen
SLC15A1 (NP_005064, a.a. 473-573) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVY
ANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPN
FNTFYLEFGSAYTYIVQRKNDSCPEVKVFE* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -