PAB28691

SLC15A1 antibody from Abnova Corporation
HPECT1, HPEPT1, PEPT1

Antibody data

Product number
PAB28691
Provider
Abnova Corporation
Product name
SLC15A1 polyclonal antibody
Provider product page
Abnova Corporation - PAB28691
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC15A1.
Antigen sequence
DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVT
LGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTD
DFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENG
IRFVNTFNELITITMSGKVYANISSYNA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -