H00006564-A01

SLC15A1 antibody from Abnova Corporation
HPECT1, HPEPT1, PEPT1
No application information provided.

Antibody data

Product number
H00006564-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006564-A01, RRID:AB_463554
Product name
SLC15A1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006564-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SLC15A1.
Antigen sequence
VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVY
ANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPN
FNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -