HPA002827

SLC15A1 antibody from Atlas Antibodies
HPECT1, HPEPT1, PEPT1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002827, RRID:AB_1856974
Product name
Anti-SLC15A1
Provider product page
Atlas Antibodies - HPA002827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVT
LGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTD
DFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENG
IRFVNTFNELITITMSGKVYANISSYNA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -