HPA002827

SLC15A1 antibody from Sigma-Aldrich
HPECT1, HPEPT1, PEPT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002827, RRID:AB_1856974
Product name
Anti-SLC15A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002827
Antibody type
Polyclonal
Antigen
Solute carrier family 15 member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVT
LGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTD
DFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENG
IRFVNTFNELITITMSGKVYANISSYNA
Storage
-20C
Provider Type Product Number
- No reagents -