HPA054267

ZNF106 antibody from Atlas Antibodies
SH3BP3, ZFP106, ZNF474
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA054267
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054267, RRID:AB_2682431
Product name
Anti-ZNF106
Provider product page
Atlas Antibodies - HPA054267
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDW
NHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSV
RSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWN
KKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSE
GFTSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -