HPA054267

ZNF106 antibody from Atlas Antibodies
SH3BP3, ZFP106, ZNF474
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA054267
Provider
Atlas Antibodies
Product name
Anti-ZNF106
Provider product page
Atlas Antibodies - HPA054267
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDW
NHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSV
RSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWN
KKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSE
GFTSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -