Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109554 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 106 Homolog (ZFP106) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP106 antibody: synthetic peptide directed towards the N terminal of human ZFP106.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSI
KSHVSYETEGFESAS- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Dual promoter structure of ZFP106: regulation by myogenin and nuclear respiratory factor-1.
Grasberger H, Ye H, Mashima H, Bell GI
Gene 2005 Jan 3;344:143-59
Gene 2005 Jan 3;344:143-59
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Muscle; WB Suggested Anti-ZFP106 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:62500. Positive Control: Human muscle; ZFP106 antibody - N-terminal region (AP42190PU-N) in Human Muscle cells using Western Blot