Antibody data

Product number
H00001340-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001340-M01A, RRID:AB_1204169
Product name
COX6B1 monoclonal antibody (M01A), clone 5D3
Provider product page
Abnova Corporation - H00001340-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant COX6B1.
Antigen sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYL
DFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV
TDWDEQRAEGTFPGKI
Isotype
IgG
Antibody clone number
5D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -