Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001340-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001340-B01P, RRID:AB_1573145
- Product name
- COX6B1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human COX6B1 protein.
- Antigen sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYL
DFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV
TDWDEQRAEGTFPGKI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of COX6B1 expression in transfected 293T cell line (H00001340-T01) by COX6B1 MaxPab polyclonal antibody.Lane 1: COX6B1 transfected lysate(9.46 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- COX6B1 MaxPab polyclonal antibody. Western Blot analysis of COX6B1 expression in HepG2 .
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to COX6B1 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol