HPA004192

COX6B1 antibody from Sigma-Aldrich
COX6B, COXG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004192
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004192, RRID:AB_1847180
Product name
Anti-COX6B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004192
Antibody type
Polyclonal
Antigen
Cytochrome c oxidase subunit VIb isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDF
HRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTD
WDEQRAEGTFP
Storage
-20C
Provider Type Product Number
- No reagents -