HPA023378

BRF2 antibody from Atlas Antibodies
BRFU, FLJ11052, TFIIIB50
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023378
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023378, RRID:AB_1845446
Product name
Anti-BRF2
Provider product page
Atlas Antibodies - HPA023378
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGL
RRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -